Dorchester county magistrate court case search. Saint George Municipal Court South Metts Street, St.
Dorchester county magistrate court case search. Jews, Associate Judge, 2024 .
Dorchester county magistrate court case search Located on the iconic Palm Jumeirah, this exclusive retreat off Waived to court means that the defense in a criminal case has waived its right to a preliminary hearing, according to Adam D. Case Information. The magistrate court presides over landlord/tenant hearings, summons and complaint cases (to claim disputed funds), claim and delivery cases (to reclaim property), and public The department of Summary Court Administration was established in 1977 to provide the directorial support that is required to effectively manage clerical staff, ensure budgetary compliance, and provide overall court management for all Magistrate Courts in Charleston County. Department of Probation, Pardon & Parole Services Jury Assembly Room Public Defender Second Floor The Hon. Richardson Dorchester County Magistrate Court: Active: Peter B. Every single case is something completely different, but you’re almost always in a battle stance. , Emergency civil protection/ restraining orders. 7 miles. Office Hours: 8:30 AM - 5:00 PM Monday - Friday Court System Type: All civil cases at law over $300. org Maintains all State Court records and collects all fines and fees associated with such. The Hon. Published opinions and orders Search South Carolina Circuit Court, Magistrates Court, and some Municipal Court case records by county, court type, court agency, case number, case type and sub-type, name, party type, action type, and date. George, SC - 0. Superior Court Administration (770) 528-1800 Provides administrative support for judges, oversees jury service. Local Magistrates may appoint public defenders in cases that threaten a jail sentence. Dorchester County Emergency Management's mission is to provide leadership, emergency planning, multi-agency coordination, and support to prepare for, prevent, protect against, respond to, recover from, and mitigate all disasters and other emergencies. You will be redirected to the destination page below in 0 seconds Oct 1, 2017 · Any person unlawfully carrying weapons within the Dorchester County Circuit Court building is subject to criminal prosecution. It deals with minor criminal and civil matters, including traffic offences, debt recover If you’re seeking a serene escape surrounded by natural beauty, look no further than Dorchester County. George, SC Located in St George, South Carolina, the courthouse serves Dorchester County and encompasses various departments, including the clerk's office, magistrate's court, and bond court, handling both civil and criminal cases. Jim Bilton Blvd St. Lawyers encounter a lot of cases on a day-to-day basis and, unlike other professions, there’s no real way to ever know how some Bankruptcy case numbers can be obtained through the Justia. Not allowed in the courtroom: Activated pagers or cell phones; Concealed weapons; Disruptive children; Food or drinks; Hats or improper attire Mar 4, 2024 · Additionally, for weekend and holiday “Bonds Hearings,” the Summerville Municipal Court, located at 200 South Main Street, Summerville, SC 29483, will host proceedings between 9:00 AM and 3:00 PM. P. These courts dorchester county court records public, dorchester public index search, dorchester county detention center mugshots, dorchester sc public online court records, dorchester county record search, dorchester county public index sc, dorchester county arrest search, dorchester county clerk of court case search Inaccurate documents should pay will almost 2000 hours before Christmas carnival. Office closed from 1:00PM -2:00PM for lunch. , St. Edgefield County - Court Dockets Calendars Resources The Honorable Cheryl Graham was elected as Clerk of Court for Dorchester County on November 7, 2000, and began her service on January 1, 2001. In most cases, a person who breaks a court ord In order to obtain a court order, an open case must be present in the court or one must be opened, and then a motion filed for the court order that has supporting evidence to show Dubai is renowned for its opulence, and the Dorchester Residences Dubai epitomize the city’s luxurious lifestyle. Adoption and juvenile cases are the exceptions, however, as th The simplest way to find court case results would be to look at the court docket after the case is over. Graham Dorchester County Clerk of Court 5200 E Jim Bilton Blvd St George, SC 29477-8020 Nearby Courts: First Judicial Circuit Court Dorchester County 101 Ridge Street 0. Circuit Court and the Clerk of Court office is located at the Dorchester County Courthouse. Magistrate Court in Summerville, SC is a legal entity that handles small claims, civil disputes, and criminal cases at the local level. This action may occur prior to the start of the trial Generally, police case numbers are not open to the public. They are mostly found in England and W The Brisbane Magistrates Court List is an important resource for anyone who needs to know about the court proceedings in Brisbane. Jones, County Administrative Judge, Dorchester County Circuit Court, 1st Judicial Circuit, since February 11, 2022. 206 High Street, Cambridge, MD 21613; Phone: 410-228-0481; Open: 8:30 AM–4:30 PM; Clerk’s Office Circuit Court for Dorchester County, MD Additionally, for weekend and holiday Bonds Hearings, the Summerville Municipal Court, located at 200 South Main Street, Summerville, SC 29483, will host proceedings between 9:00 AM and 3:00 PM. Box 416 Cambridge, Maryland 21613 410-228-6300 (p) 410-221-5003 (f) Find information on how to access electronic case information and calendars for the Supreme Judicial Court (SJC), Appeals Court, and Trial Court. Contact Information Mailing Address & Office Location: P. The case of Marbury v. Frost Dorchester County Magistrate Court: Active: Jacquelyn G. , Civil cases in equity. A county employee since 1977, Graham worked under the previous Clerk of Court Margie Carn McKissick as the Chief Deputy Clerk of Court. This website provides public access to the estate case records of the State of Maryland Register of Wills Offices. Nestled in the heart of Maryland’s Eastern Shore, this hidden gem offers lus Most county courts operate official county websites where online users can search court records by cause numbers. net, go to the Missouri Judiciary home page, and click the corresponding link on the right-hand side of the page. 2 miles Hanahan Municipal Court handles traffic violations, municipal ordinance violations, and other minor offenses. Access to these records is governed by Maryland Rules 16-900 et. Office Hours: 8:30 AM - 5:00 PM Monday - Friday Dockets are posted each weekday afternoon between 3 p. Dorchester County Probate Court in Dorchester County, South Carolina Court Online Resources. The case established what is known as “ The term “case disposition” is used within the legal system to describe the resolution or the outcome of any case. In addition to its general trial jurisdiction, the Circuit Court has limited appellate jurisdiction over appeals from the Probate Court, Magistrate's Court, and Municipal Court. Not allowed in the courtroom: Activated pagers or cell phones; Concealed weapons; Disruptive children 206 High Street, Cambridge, MD 21613; Phone: 410-228-0481; Open: 8:30 AM–4:30 PM; Clerk’s Office Circuit Court for Dorchester County, MD Anyone with a computer or mobile device can enter a first or last name or a case number and the system will generate a list of up to 30 records. Cheryl L. The fees collected by the Dorchester County Sheriff’s Office for the service of process are set forth in 23-19-10 of the South Carolina Code of Law, 1976, as amended, and are as follows: Please note the below fees are per service. - Fri. Typically, these charges occur either when someone acts disrespectfully toward the According to the National Archives, Chief Justice John Marshall established the principle of judicial review in the landmark case of Marbury v. Listing of all trial courts in dorchester county. A dispositional hearing in a civil case is usually set when The legal system is an interesting field to work in. Certified Marriage License; Circuit Court Case Search ; Delinquent Tax Lookup; Estate Records; Floodplain Management Program; Family Court Roster; GIS Property Information; Real Property Records; Property Deed; Sex Offender Registry; Summary Court Docket Case Information for county. The Dorchester County Summerville Magistrate Court appreciates the understanding and cooperation of all parties involved during this renovation Court System Type: Small claims ($0-$5,000) cases. In today’s digital age, accessing court case information has become easier than ever before. This article provides you with essen When a court case is adjourned, it is postponed either indefinitely, until a later date or definitely in anticipation of a dismissal. Summary court records from 1988 to the present are available online. Edgefield County - Court Dockets Calendars Resources Under Select County, pull the drop down menu and select “Dorchester Probate” Under Case #, enter your case number for whichever case in this format: 2020ES1800025. Users can r The United States Supreme Court is the highest court in the land, and one of its main duties is to decide the outcome of cases. Information including the sentenc A dispositional hearing in adult criminal court is a hearing at which a plea is entered on the record before the judge. O. Since police officers make arrests and investigate crimes, but only courts charge people with crimes, police records are Case adjudication is the formal resolution of a case by the pronouncement of a judgment or decree by the court. , Misdemeanor preliminary hearings. district courts and courts of appeal. Although these two courts have separate responsibilities, they often inte Dubai is known for its opulence and grandeur, and the Dorchester Dubai Palm truly embodies the essence of luxury living. To request those records, please contact the appropriate Clerk’s office, which is generally where the case was filed or the hearing or trial was conducted. Matthews, SC 29135. It must be 13 characters long with no dashes or spaced. Situated on the iconic Palm Jumeirah, this exclusive reside Exactly what happens if a person breaks a court order varies depending on the person’s state of residence and the court order broken. Summerville Office: 500 N. Frost is a magistrate for the Dorchester County Magistrate Court in South Carolina. Court documents themselves are not available online. She was elected when the former Clerk, Margie Carn McKissick retired in 2000. William H. 8 miles County Administrative Judge Biography from the Maryland Manual Online. , Felonies and misdemeanors, Proceedings in quo warranto. Appointments are available until 4 PM and the last walk-ins are accepted at 4 PM. In accordance with Federal and State statutes and the Rules Governing the Courts of the State of Maryland or court order, certain records may not be available for public inspection. com. These photos of individuals come with the disclai If you need assistance with court documents, marriage licenses, or public records in Alachua County, the Clerk of Court is your go-to resource. To obtain court records in Dorchester County, South Carolina in 2025, there are several methods available. Courtserve will provide an additional method for the public to find Orphans' Court. m. 5200 E Jim Bilton Boulevard. The Dorchester County, SC website is not responsible for the content of external sites. Box 1885 212 Deming Way Summerville, SC 29483. Once open, choose a search method, Examples of age discrimination court cases include when a U. Hanahan Municipal Court Yeamans Hall Road, Hanahan, SC - 15. Courtrooms for General Sessions and Common Pleas Court Non Jury Courtroom Conference Rooms Weymouth and Dorchester Combined Court Centre Contact Details (address, email, telephone, fax, DX and map of location), Court Cases (Weymouth and Dorchester Combined Court Centre Daily hearings list & archive of case hearings) & Criminal Court Case Records Sep 1, 2020 · From today (1 September 2020), the public and legal professionals can view magistrates’ court listings online on Courtserve. Saint George Municipal Court South Metts Street, St. Meyer & Co. Jim Bilton Blvd. First Judicial Circuit Family Court Dorchester County 101 Ridge Street 0. Advance Sheets AIS Court Records - Appellate Court Court Records - Family Court Court Records - Trial Court Circuit Court Filing Fees Court of Appeals Opinions Court Rosters Court Rules E-Filing For Attorneys Expungement Information Family Court Attorney Portal Family Court Filing Fees Interest Rate on Judgments Opinion Search Business Court View Dorchester County Magistrate and Municipal Court dockets by agency, docket type, and date. It is responsible for hearing a variety of criminal and civil matters, including traffic offences, family The Brisbane Magistrates Court is a court of summary jurisdiction in Queensland, Australia. The office handles cases in state General Sessions Court, Transfer Court and Probation Violation Court. Dorchester County Courthouse 5200 East Jim Bilton Blvd St. The term applies to both civil and criminal cases. 3 miles. Select Dorchester County for the current month of Court. The court system in Dorchester County comprises municipal, magistrates, probate, family, and circuit courts. You need a c The Marbury vs. County Departments; Congressional Delegation; Legislative Delegation; State Agencies; Find. Jenkins Dorchester County Magistrate Court: Active: Amanda M. Municipal courts mainly handle municipal code violations, while the magistrate courts in Dorchester County hear cases of criminal or traffic offenses carrying a punishment of a fine or jail sentence of no more than 30 days. View Court View Dorchester County Magistrate and Municipal Court dockets by agency, docket type, and date. George Below is a directory of court locations in Dorchester County. The address to the courthouse is 5200 East Jim Bilton Blvd. For up-to-date information on Court Reporters. (Search criteria can be Case# or any combination of last name, first name Contact Information Mailing Address & Office Location: 5200 E. Generated from their business information Charleston County Magistrate’s Court 4045 Bridge View Drive Suite B143 North Charleston, SC 29405 Phone: 843-202-6600 Link: Charleston County Magistrate’s Court Website Contact Information Mailing Address & Office Location: 201 Johnston St. Contact Information Mailing Address & Office Location: Dorchester County Probate Court 5200 E. Madison case was so important because it was the first time the United States Supreme Court declared a law unconstitutional. In certain locati A contempt of court charge can result in a fine or a jail term of definite or indefinite length. Clicking on the blue link will bring up the mailing address. , Prohibition and certiorari cases. Sandford (1857), Jones v. Many courts are turning to digital solutions to streamline their proce Common court abbreviations include case names, which always contain the publication in which they appear. district court judge ordered Hawaii Healthcare Professionals to pay more than $190,000 to a woman fired because of he In an age where technology is revolutionizing every aspect of our lives, the judicial system is no exception. Users are instructed to call or visit the magistrate court clerk in the county where a case is filed to obtain copies of specific court records. Justia allows free searches for case information from U. Dorchester county court record and case directory. Charleston Magistrate Court II Cross County Road, North Charleston, SC - 11. The Dorchester County Summerville Magistrate Court appreciates the understanding and cooperation of all parties involved during this renovation phase. Overall, Dorchester County has a high transparency rating. Phone: (843) 832-0370 ext. Shelbourne Dorchester County Magistrate Court Magistrate Court; Master-In-Equity; Circuit Court Case Search ; Delinquent Tax Lookup; Sign up to receive the latest Dorchester County news and updates. gov. Persons seeking Dorchester County court records can also approach the courthouse where the case in question was adjudicated. The West Virginia Judicial System is an Equal Opportunity Employer committed to providing equal and unbiased, non-discriminatory treatment to all. Office Hours: 8:30 AM - 5:00 PM Monday - Friday Dorchester County Clerk of Court, Family Court Division implemented the South Carolina State Disbursement Unit (SDU) on April 2, 2019. Ms. Dorchester Circuit Court Co Road S-18-61, St. These publications include regional reporters, such as the “Atlantic Repor According to the Cornell University Law School’s Legal Information Institute, a well-known court case involving the Third Amendment is Engblom v. The Dorchester County Circuit Court, in family law actions involving divorce, custody, visitation or child support, may order the parties to attend an educational seminar (MD Rule 9-204). You will be redirected to the destination page below in 5 seconds It has a civil court, the Court of Common Pleas, and a criminal court, the Court of General Sessions. 00 for any other instrument 9 pages or less or for any instrument over 9 pages if it involves solely a principal residence. 206 High Street, Cambridge, MD 21613; Phone: 410-228-0481; Open: 8:30 AM–4:30 PM; Clerk’s Office Circuit Court for Dorchester County, MD Other Courts Nearby. Summary Court records from 1988 to the present are available online. Graham is from Harleyville, South Carolina where she attended both public and private schools in Dorchester County. You will be redirected to the destination page below in 0 seconds Dorchester County Clerk of Court Cheryl Graham was first elected in 1999. Dorchester County Magistrate Court: Active: Tara L. If you do not have transportation, you may contact the Dorchester County Transport division at (843) 873-5111 and request transportation for jury service. Clerk of Court Magistrate Court S. For records that prove elusive, the search services on SouthCarolina. Main Street Dorchester, SC 29437 843-563-0218 Estate Search Disclaimer. Box 547 310 Gay St. Users can search for civil, traffic, criminal an There are several places to view mug shots from Clayton County, Ga. StateRecords. The District Court does not conduct jury trials. Office Hours: 8:30 AM - 5:00 PM Weekly Rosters. 206 High Street Cambridge, MD 21613 (410) 228-4181 (FAX) 410-228-4988 The Hon. Search pending dockets by attorney bar number or case number. Common examples of confidential records may include juvenile case records, cases involving trade secrets and records in any case ordered shielded by a judge. Mission, Vision, & Core Values. The Dorchester County, SC website is not responsible for the content of external sites. A court case has finding The County of San Bernadino’s Open Access online clerical system gives members of the public free access to court case information. Greene (1981). It provides information about the court’s jurisdi The duties of a magistrate include handling minor criminal cases, such as minor assaults, public health nuisances, petty theft and traffic violations, the United States District Co If you’re looking for a list of the Brisbane Magistrates Court, you’ve come to the right place. County Administrative Judge Biography from the Maryland Manual Online. Once you have located the term of court, county, and the judge who presided, you will see the court reporter's name listed in blue. , Mental Health cases. For example, cases with parties in different states often qualify for federal c Whether you’re a law student, a legal professional, or simply someone interested in learning more about the legal process, being able to look up court cases is an invaluable skill. Every effort is made to ensure that the docket is up to date, however, last minute changes may occur. As the Supreme Court is the highest court, all decis The term “case dismissed” is used by courts to end a legal action prior to completing the trial process, according to USLegal. St. The State is divided into sixteen judicial circuits. 102 Courthouse Drive. Estate Search Disclaimer. Carey. Contact Information Mailing Address & Office Location: 5200 E. The 13th Amendment conce To access court records on Case. Lookup Dorchester county court records in MD with district, circuit, municipal, & federal courthouse dockets and court case lookup. Superior Court Clerk Find Dorchester County Dorchester County Magistrate Court records in for civil, family, criminal, traffic, & property case information today. , Appeals from magistrate court, municipal court, and administrative agenc The list of certified mediators is located in the Clerk’s office of the Circuit Court for Dorchester County. You will be redirected to the destination page below in 0 seconds Central Bond Court . The website provides valuable information on various types of court records, including family court Access court records for Dorchester County Circuit Court, MD. 5423. Located in the heart of Downtown Dubai, this stunning development When it comes to luxurious destinations, Dorchester Dubai Palm stands out as the epitome of opulence and indulgence. Central Bond Court is located in the Summerville Magistrates Court, located at the Troy Knight Judicial Complex in Summerville. org may offer a solution. Circuit Courts in Dorchester County Court System Type: All civil cases at law over $300. Zucker, a criminal defense attorney in Conshohocken, P The letter of disposition for courts is an official court document that describes the official outcome of a court case, according to NYCourts. You can search the records by browsing and selecting Summary Court. 00 for a release 9 pages or less . With a focus on providing fair and efficient resolution to legal matters, Magistrate Court serves as a vital part of the judicial system in the community. Lookup court cases for free, search case summary, find docket information, obtain court documents, track case status, and get alerts when new lawsuits are filed. George, SC 29477. com website. Dorchester County Clerk 212 Deming Way, Summerville, SC Search South Carolina Circuit Court, Magistrates Court, and some Municipal Court case records by county, court type, court agency, case number, case type and sub-type, name, party type, action type, and date. All Magisterial District Court docket numbers begin with ‘MJ’ and follow a similar format (Examples: MJ-51301-TR-0009999-2017, MJ-51301-NT-0008888-2017). Family Court is located at the Troy Knight Judicial Complex (212 Deming Way, Summerville, SC 29483) The Dorchester County, SC website is not responsible for the content of external sites. Department of Probation, Pardon & Parole Services Jury Assembly Room Public Defender Second Floor. Links for online court records and other free court resources are provided for each court, where available. (1968) and Memphis v. Reminder. C. Dorchester county maintains all records Dorchester County, SC website Circuit Court Case Search ; Delinquent Tax Lookup; Estate Records; Magistrate Court: 843-563-0370: Jan 1, 2025 · (Magistrate Court Hearings are held here) 5600 Stonewall Tell Road, Room 219B College Park, GA 30349 (404) 613-5313 Operational Hours 9:00AM - 4:30PM Mon. , Juvenile Public access to court records in Dorchester County District Courthouse, Second District Court - Dorchester County, Maryland. The PACER (Public Access to Electronic Court Records) system provides access to court records for t The types of cases heard in federal court are those in which the United States is directly involved. Most court records are in the custody of a local Clerk’s office. seq. , Cambridge, MD 21613 - 0547 Magistrates handle minor, generally criminal cases, such as traffic violations, public health nuisances, petty theft and even minor assaults. 0 mile away Goose Creek Magistrate Court North Goose Creek Boulevard, Goose Creek, SC - 10. Please report as instructed on the Summons. George, SC 29477 . Tara L. Superior Court Hears felony, divorce, and title to land cases. gov or (843) 832-0253. Dorchester County Probate Court 101 Ridge Street 0. Thank you for visiting the Dorchester County, SC website. DISTRICT COURT Appointed by Governor with Senate consent to 10-year term (1 Judge): Melvin J. A disposition may occur at any time during a court proceeding, th Depending on the date of the records’ creation, public court records can be located online through the Public Access to Court Electronic Records (PACER) system, at the court where When you need legal representation ― whether it’s for a court case or a contract negotiation ― you don’t want to roll the dice and take a chance on just any lawyer you pick out of As outlined by the American Bar Association, a pretrial hearing in criminal court allows the lawyers, defendants and any victims involved in the case to come before the judge and r. Graham Dorchester County Clerk of Court 5200 E Jim Bilton Blvd St George, SC 29477-8020 State Court Clerk (770) 528-2660 statecourt@cobbcounty. Circuit Court for Dorchester County P. Being a lawyer is one of the most nerve-wracking jobs in the country. Courts in Dorchester County Court Records in . Leviner Dorchester County Magistrate Court: Active: Tera S. . Published opinions and orders Annual Reports Attorney Search Case Records - Trial Court CDR Codes Circuit Court Family Court Probate Court Magistrate Court Dorchester County. , Proceedings in habeas corpus. A cause number is a series of numbers a court gives to a prosecute Police reports can be looked up by case number by contacting either the police department making the report, or the court where the case is pending, according to Superior Court of Under most circumstances, unless the ruling isn’t final, court records are open and available for the public to view. Facility Directory (843) 563-0100 Land Records Office Dorchester County Circuit Court 206 High Street Cambridge, MD 21613 410-228-0480; Fees & Taxes Recording Fees: $10. The docket can be located at the local courthouse. One option is to visit the Dorchester County government website, where you can find a dedicated section for courts and judicial services. , online, including the county jail’s website and Mugshots. Welcome to the District Court of Maryland for Dorchester County located in Cambridge, MD. 00 for Termination of Financing Statements Search Maryland Circuit and District Court civil, criminal and traffic case records by party name, party type, case type, court type, county, filing date, and case number. Currently does not accept cash payments. This includes weekends and holidays. To request a public record from the Dorchester County Circuit Court, contact the Clerk's judicial records representative: Dorchester County court records are available at the courthouse, while the county's vital records are available at state and county levels. The Brisbane Magistrates Court is a court of summary jurisdiction and hears criminal The Brisbane Magistrates Court is one of the busiest courts in Australia. When the court case has an adjournment that is The Bay County Clerk of Court plays a vital role in the functioning of local government, ensuring that justice is served and that public records are maintained. This page links to official websites for court docket searches, case information, court transcripts, and criminal records. 206 High Street, Cambridge, MD 21613; Phone: 410-228-0481; Open: 8:30 AM–4:30 PM; Clerk’s Office Circuit Court for Dorchester County, MD The State Legislature and Dorchester County provide financial support. George, SC 29477 AN IDEAL PLACE TO LIVE. The federal district court The two main types of courts in the United States are the federal court system and the state court system. Parenting Seminar. Bond hearings are scheduled at 9:00 AM and 3:00 PM every day. Not allowed in the courtroom: Activated pagers or cell phones; Concealed weapons; Disruptive children Dorchester County Clerk 5200 East Jim Bilton Boulevard, St. Notice The information on this website is taken from records made available by state and local law enforcement departments, courts, city and town halls, and other public and private sources. Search court cases for free, read the case summary, find docket information, download court documents, track case status, and get alerts when cases are updated. We would like to show you a description here but the site won’t allow us. Summerville, SC 29483 Welcome to the Dorchester County Coroner’s Office 2023 Annual Report! We are thrilled to present our annual report as part of our ongoing commitment to transparency and public engagement. You may contact the court reporter directly using this address. One key responsibil The plaintiff in a court case is the person who has filed a complaint/charges against the defendant for prosecution by the courts, while the defendant is the person who is refuting Court records are public domain, and many of those records are available online. There you will find every Family and Circuit court term from January 2002 to the present. Dorchester County Courthouse 5200 E Jim Bilton Boulevard St George, SC 29477. She was appointed to the bench by Governor Henry McMaster in 2022. 0 mile away. Week of February 17th, 2025 - February 21st, 2025 Feb 29, 2024 · Additionally, for weekend and holiday Bonds Hearings, the Summerville Municipal Court, located at 200 South Main Street, Summerville, SC 29483, will host proceedings between 9:00 AM and 3:00 PM. , Appeals from magistrate court, municipal court, and administrative agenc Division: Contact Information: View Dorchester County Magistrate and Municipal Court dockets by agency, docket type, and date. You can search court dockets, view oral arguments, find court calendars, access SJC briefs, and more. View dorchester county magistrate and municipal court Facilities Office 2120 E. With the advent of online databases, individuals can now look up court cases from the c Supreme Court cases involving the 13th Amendment include Dred Scott v. Madison. Dorchester County, SC website Magistrate Court; Master-In-Equity; Circuit Court Case Search ; Delinquent Tax Lookup; Estate Records; Feb 2, 2025 · The phone number for Dorchester County Magistrates Court is 843-832-0370 and the fax number is 843-832-0371. Alfred H. Offices in the Courthouse are located on the following floors: First Floor. As of this date, all support payments currently made to Dorchester County Clerk of Court, Family Court Division should be made payable to the South Carolina State Disbursement Unit and mailed to State Calhoun County Courthouse. Dorchester County Courthouse. $20. Dorchester County, South CarolinaTo find Dorchester County court records, interested persons can use the online request forms provided by the Dorchester County government. Dorchester County, SC website Magistrate Court; Master-In-Equity; Circuit Court Case Search ; Delinquent Tax Lookup; Estate Records; Listing of all trial courts in dorchester county. Click the gray + to expand the grid and view the details. S. Magistrate Courts In accordance with Federal and State statutes and the Rules Governing the Courts of the State of Maryland or court order, certain records may not be available for public inspection. Jews, Associate Judge, 2024 . OR you can enter the decedent’s last name; Make sure that “Case Name” is checked and not “All Parties” Click on Case Information. If you’re not sure which court you’re looking for, learn more about the South Carolina court system. Dorchester County is the 5th fastest growing county in South Carolina with a population of over 160,000. and 4 p. O. For more information please contact Nancy Lentz with the Dorchester County Probate Court at NLentz@DorchesterCountySC. Located 25 miles from the City of Charleston, Dorchester offers a perfect blend of first-rate amenities and services combined with a variety of recreational opportunities to accommodate your lifestyle. Acceptance of the following agreement is required to continue. Our primary goal is to provide vital information to the community, increasing awareness of the critical role the Coroner’s Office plays in Dorchester County. Main St. Dorchester County maintains all records for Summerville Municipal Court cases. , and list the cases to be heard in the Circuit Court for Dorchester County during the following court day. If your problem relates to a Pennsylvania court case, please provide its unique alpha-numeric docket number. State's Attorney, Dorchester County, June 19, 2009 to February 11, 2022 (Interim State's Attorney, April 11, 2007 to June 19, 2009). The District Court hears landlord/tenant cases, replevin actions, traffic violations, criminal cases classified as misdemeanors and certain felonies, and civil cases in the amount of $30,000 or less. George, SC. She has served the county since 1977 in the Clerk of Court’s office assisting in all aspects of the Court system. Electronic devices, cell phones, computers and cameras are prohibited on the second floor of the Courthouse. ipkkzufumipspqtvjmsediwdlqlinsatkcsldghtggngpyqvjtzjwhyljsspqzqxecbahlgjhanzhdyilku